General Information

  • ID:  hor001865
  • Uniprot ID:  NA
  • Protein name:  Glucagon-like peptide 1
  • Gene name:  NA
  • Organism:  Pyxicephalus adspersus
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  HAEGTFTSDMTSYLEEKAAKEFVDWLIKGRPK
  • Length:  32
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001865_AF2.pdbhor001865_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 423927 Formula: C166H254N42O51S
Absent amino acids: CNQ Common amino acids: EK
pI: 5.7 Basic residues: 6
Polar residues: 8 Hydrophobic residues: 10
Hydrophobicity: -73.13 Boman Index: -6436
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 55
Instability Index: 2005 Extinction Coefficient cystines: 6990
Absorbance 280nm: 225.48

Literature

  • PubMed ID:  10882553
  • Title:  Islet Hormones From the African Bullfrog Pyxicephalus Adspersus (Anura:Ranidae): Structural Characterization and Phylogenetic Implications